SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077080 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077080
Domain Number 1 Region: 855-936
Classification Level Classification E-value
Superfamily DEATH domain 2.24e-22
Family DEATH domain, DD 0.00000719
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000223
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 4 Region: 298-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000202
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077080   Gene: ENSMUSG00000020099   Transcript: ENSMUST00000077925
Sequence length 945
Comment pep:known chromosome:NCBIM37:10:60225358:60294329:-1 gene:ENSMUSG00000020099 transcript:ENSMUST00000077925
Sequence
MRARSGVRSALLLALLLCWDPTPSLAGVDSAGQVLPDSYPSAPAEQLPYFLLEPQDAYIV
KNKPVELHCRAFPATQIYFKCNGEWVSQNDHVTQESLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTL
NDPKSHPLETSGDVALYAGLVVAVFVVVAVLMAVGVIVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPNNPQLLHPSAPPDLTASAGIYRGPVYALQDSADKIPMTNSPLLDPLPSL
KIKVYNSSTIGSGSGLADGADLLGVLPPGTYPGDFSRDTHFLHLRSASLGSQHLLGLPRD
PSSSVSGTFGCLGGRLSLPGTGVSLLVPNGAIPQGKFYDLYLHINKAESTLPLSEGSQTV
LSPSVTCGPTGLLLCRPVVLTVPHCAEVIAGDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEAKSCHILLDQLGTYVFMGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFY
HVWNGSQRALHCTFTLERHSLASTEFTCKVCVRQVEGEGQIFQLHTTLAETPAGSLDALC
SAPGNAITTQLGPYAFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEARQQDDGDLNSLASALEEMGKSEMLVAMATDGDC
Download sequence
Identical sequences Q8K1S3
NP_084046.2.92730 ENSMUSP00000077080 NYSGRC-IgSF-Q8K1S3 ENSMUSP00000077080 10090.ENSMUSP00000077080 ENSMUSP00000077080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]