SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000084910 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000084910
Domain Number 1 Region: 149-351
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.68e-53
Family Prokaryotic proteases 0.000000574
Further Details:      
 
Domain Number 2 Region: 361-456
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-19
Family HtrA-like serine proteases 0.0018
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000008
Family Growth factor receptor domain 0.0031
Further Details:      
 
Domain Number 4 Region: 86-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000398
Family Ovomucoid domain III-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000084910   Gene: ENSMUSG00000029096   Transcript: ENSMUST00000087629
Sequence length 459
Comment pep:known chromosome:NCBIM37:5:35994690:36022431:-1 gene:ENSMUSG00000029096 transcript:ENSMUST00000087629
Sequence
MQARALLPATLAILATLAVLALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVC
AASEGEPCGRPLDSPCGDSLECVRGVCRCRWTHTVCGTDGHTYADVCALQAASRRALQVS
GTPVRQLQKGACPSGLHQLTSPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSS
GSGFIMSEAGLIVTNAHVVSSSSTASGRQQLKVQLQNGDAYEATIQDIDKKSDIATIVIH
PKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGLRDSDMDYI
QTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDRITRFLSEFQNKHVKDWKK
RFIGIRMRTITPSLVEELKAANPDFPAVSSGIYVQEVVPNSPSQRGGIQDGDIIVKVNGR
PLADSSELQEAVLNESSLLLEVRRGNDDLLFSIIPEVVM
Download sequence
Identical sequences Q9D236
ENSMUSP00000084910 NP_084403.2.92730 ENSMUSP00000084910 ENSMUSP00000084910 10090.ENSMUSP00000084910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]