SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088837 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088837
Domain Number 1 Region: 1000-1285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-79
Family Protein kinases, catalytic subunit 0.0000000000678
Further Details:      
 
Domain Number 2 Region: 333-498
Classification Level Classification E-value
Superfamily L domain-like 8.51e-51
Family L domain 0.0000000954
Further Details:      
 
Domain Number 3 Region: 33-194
Classification Level Classification E-value
Superfamily L domain-like 4.54e-44
Family L domain 0.0000001
Further Details:      
 
Domain Number 4 Region: 495-620
Classification Level Classification E-value
Superfamily Fibronectin type III 2.6e-31
Family Fibronectin type III 0.00000018
Further Details:      
 
Domain Number 5 Region: 792-934
Classification Level Classification E-value
Superfamily Fibronectin type III 2.88e-24
Family Fibronectin type III 0.00000222
Further Details:      
 
Domain Number 6 Region: 624-704,798-822
Classification Level Classification E-value
Superfamily Fibronectin type III 8.08e-20
Family Fibronectin type III 0.000000899
Further Details:      
 
Domain Number 7 Region: 180-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000144
Family Growth factor receptor domain 0.0000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088837   Gene: ENSMUSG00000005534   Transcript: ENSMUST00000091291
Sequence length 1372
Comment pep:known chromosome:NCBIM37:8:3150922:3279617:-1 gene:ENSMUSG00000005534 transcript:ENSMUST00000091291
Sequence
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPT
SQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKA
DDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG
CRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSV
VIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLRELG
QGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLL
GVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYL
NAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKD
GVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMR
MCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELEMEFEDMENVPLD
RSSHCQREEAGGREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPRSNPS
Download sequence
Identical sequences P15208
ENSMUSP00000088837 ENSMUSP00000088837 ENSMUSP00000088837 NP_034698.2.92730 10090.ENSMUSP00000088837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]