SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091192 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091192
Domain Number 1 Region: 200-320
Classification Level Classification E-value
Superfamily EF-hand 5.68e-36
Family Osteonectin 0.0097
Further Details:      
 
Domain Number 2 Region: 289-382
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.05e-28
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 138-183
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000236
Family Ovomucoid domain III-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091192   Gene: ENSMUSG00000054162   Transcript: ENSMUST00000093480
Sequence length 436
Comment pep:known chromosome:NCBIM37:8:65430597:65835891:1 gene:ENSMUSG00000054162 transcript:ENSMUST00000093480
Sequence
MLKVSALLCVCAAAWCSQTLAAAAAVAVAGGRSDGGNFLDEKQWLTTISQYDKEVGQWNK
FRDEVEDDYFRTWNPGKPFDQALDPAKDPCLKTKCSRHKVCITQDAQTALCISHRRLTHS
MKEVGGSHKQWRGLPSSTCKPCPIAYASPVCGSDGHSYSSQCKLEYQACVLGKQISIKCE
GRCPCPSDKSMNIGRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKALLRPERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCHTELSNIQKRQGIKKLLGQYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVVGSRINGVADCAIDFEISGDFASGDFREWTDDEGEEDDIMNDKDDIEDDDE
DEGDDDDDGDVHDGYI
Download sequence
Identical sequences Q8BKV0
NP_001239549.1.92730 NP_076178.1.92730 ENSMUSP00000112930 10090.ENSMUSP00000113683 ENSMUSP00000091192 ENSMUSP00000112930 ENSMUSP00000113683 ENSMUSP00000091192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]