SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091439 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091439
Domain Number 1 Region: 1-687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-189
Family Motor proteins 0.0000000189
Further Details:      
 
Domain Number 2 Region: 1730-1798
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000114
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 2119-2230
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000157
Family Second domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000091439
Domain Number - Region: 2056-2114
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0269
Family Ras-binding domain, RBD 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091439   Gene: ENSMUSG00000034427   Transcript: ENSMUST00000093911
Sequence length 2336
Comment pep:known chromosome:NCBIM37:11:115722926:115753906:1 gene:ENSMUSG00000034427 transcript:ENSMUST00000093911
Sequence
TFGGPLLLALNPHRSLPLFSSEVLASYHPRKAPNTTPHIFAIGAAAYSLSQSTGQDSCIL
LGGHSGSGKTEGAKKILEFLSSLGQKPMEANLAQLEDILPVLGSFGHAKTILNANASRFG
QEIRLCLQQGLIVGASVSHYLLETSRVVFQAQAERSFHVFYELLAGLDPTEREQLSLQGP
EAYYYLNQGGACRLQGKEDAQDFKELMKALRGLGLCAEELTAVWAVLATILHLGNICFSS
SERESQEVAAVSSWAEIHLAARLLQVPPERLEGAVTKRVMDTPYGPVSRPLPVEGAIDAR
DALAKTLYTRLFTWLLKHINARLSPPREADSVATIAVVDAFGFEALRVNGLEQLCSNLAS
ERLQLFSSQKLLAQEEEVCQQELLKWVPIPQPPRQSCLDLLVGQPHSLLNILDTQTWLSQ
ATDHTFLQKCHYHHGDHPSYAKPQLPLPIFTVRHYAGTVTYQVHKFINRNRGHLDPAVLE
MLRQSQLQLMGSLFQEAEPQAGTEQNKPTLASRFQQTLGDLLARLGRGHVYVIHCLNPTP
GKIPGLLDVGHVAEQLRQAGILEIIGTRSTHFPVRVSFQVFLARFHALGSGRQKAASDQE
RCGAILSEVLGAESPLYHLGVTQVLLQEQGWQQLEQLWAQRRSQALLTLHRGLRACITRQ
RLRLLPRMQARVRGLQARKRYLQRRSALGQLNTILLVARPLLRRRQKLRCAPGPHSGEPW
GKVSNMDLGRLEIPAQLATLLERAEGHQALLTGSITESLPPEVPARPSLTLPPDIDQFPF
SSFVSTSFQKPFLPRPGQPLDEPLTRLDGENPQQALEINRVMLRLLGEGSLQSWQEQTMG
TFLVQQAQRRPGLRDELFSQLVAQLWRNPDEQQNQRGWALMVILLSSFAPTPALEKPLLK
FVSDQAPSGMAALCQHKLLGALEQTPLAPMASRSHPPTQLEWKAGLRRGRMALDVFTFNE
ESYSAEVESWTTGEQFAGWILQSRGLEAPPRGWSVSLHSGDAWRDLPGCDFVLDLIGQTE
DLGDPAGPHNYPITPLGLAESIPPAPGVQAPSLPPGLPPGPAPILASSRPPGEASKPENL
DGFVDHLFEPALAPGFSDLEQGWALSRRMKGGGSVGPTQQGYPMVYPGMVQAPSYQPAMI
PAPMPVMPAMGAVPTMPAMMVPPQPQPLVPSLDSRQLALQQQNFINQQAMILAQQMTTQA
MSLSLEQQNQRHQHQAQTSGATSQPPPSTTAPKAKKPPAPQEKPESNLEPSGVGLREDTP
EEAESKPQRPKSFQQKRDYFQKMGQEPIRVKTVKPPAKVQIPQEEMEETEEEEEETAELS
PPPPPPPVVKKPLKASRPKAVKEDEAEPAQEEVPTQGEDPPVHSSNSAPQHPKPSRVPPV
QSSNSAPPRPQPSREIRNIIRMYQSRPGPVAVPVQPTRPIKTFQKKNDPKDEALAKLGIN
GVHLPLSTSPNQGKSSPPAVVPRPKARPRLEPSLSIQEKQGPLRDLFGPCSPNPPTAPAP
PPPPALPPPLSGEPKTPSVESHALTEPMEDKNISTKLLVPSGSVCFSYANAPWKLFLRKE
VFYPRENFSHPYCLSLLCQQILRDTFTESCTRISQDERHKMKGLLGDLEVSLETLDIVED
SIKKRIVVAARDNWANYFSRIFPVSGESGSDVQLLGVSHRGLRLLKVTQSPSFHLDQLKT
LCSYSYAEVLTVQCRGRSTLELSLKNEQLILHTAWARAIKAMVDLFLSELRKDSGYVIAL
RSYITDDNSLLSFHRGDLIRLLPVTALEPGWQFGSAGGRSGLFPDDVVQPAAAPDLSFSL
GKRNSWQRKSKLGPAQERPTHPRKQEPSEDSEATSFTTYSSLSADPHNYTMQEFALRYFR
KPHTWLTQMSRDTKEKAAINLIQYTKDPIQESLTSFCNGDTNSKAVAGFKALMQFMGDQP
KPRGKDELSLLYELLKLCQDDLRDEMYCQVIKQVTGHPQPKHCALGWSVLSLFTGFFAPS
TTLMPYVTKFLQDSSPSEELARRSQENLQRTVKYGGRQQLPLPGEMNAFLKGQAVRLLLI
HLPGGVDYRTNSQTFTVAGEVLEELCGQMGITDLEEVQEFALFLIKGEGELVRPLSPHEY
INNVVTDQDMSLHSRRLGWETPLHFDHSTYTETHYGQVLRDYLQGKLIVSTQAEALLAQL
AAFQHFDKTGTSSPPSEQELLSYIPKPLQWQVNTANIKSLVTQELRQMQGYSKQRAQIGF
IESTAQLPLFGYTVYVVLRVSKLALPGPGLLGLNRQHLVLMDPSSQELCCSVMLKDLKQL
HLLSPLQEDGPPGLELNYGSVDNPQTIWLELPQAQELQHTIIFLLGSMSTQWPGLL
Download sequence
Identical sequences ENSMUSP00000048072 ENSMUSP00000091439 ENSMUSP00000091439 10090.ENSMUSP00000091439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]