SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097704 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097704
Domain Number 1 Region: 187-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.77e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0074
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 9.43e-26
Family Rieske iron-sulfur protein (ISP) 0.029
Further Details:      
 
Domain Number 3 Region: 506-584
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.65e-20
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097704   Gene: ENSMUSG00000022763   Transcript: ENSMUST00000100128
Sequence length 605
Comment pep:known chromosome:NCBIM37:16:17489784:17507575:1 gene:ENSMUSG00000022763 transcript:ENSMUST00000100128
Sequence
MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRGYQGNGTARHFHAEERLPTPQP
YPSPQDCVEATVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVTIRASKQALQLQRRTKV
MAKCISPSAGHSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRAKLSK
SLDAQPEQLALRPKEFFRAYGIEMLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSS
PKTLTCKGKDVENVFTIRTPEDANRVLRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSV
VELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRAQEGKLQEVVLKSSKVLRA
DVCVLGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEINTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDL
EELKFVAFYTKSDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVELFMLHSKTGDMSWL
TGKGS
Download sequence
Identical sequences Q3TY86
10090.ENSMUSP00000111349 ENSMUSP00000023448 NP_001277999.1.92730 XP_006522655.1.92730 ENSMUSP00000097704 ENSMUSP00000111349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]