SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098292 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098292
Domain Number 1 Region: 42-490
Classification Level Classification E-value
Superfamily Sema domain 9.42e-140
Family Sema domain 0.00000015
Further Details:      
 
Domain Number 2 Region: 837-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.83e-16
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 782-838
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000222
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 4 Region: 595-645
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000471
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 5 Region: 486-537
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000222
Family Plexin repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 650-701
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000968
Family TSP-1 type 1 repeat 0.00067
Further Details:      
 
Domain Number 7 Region: 896-941
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000123
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 539-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000129
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098292   Gene: ENSMUSG00000022231   Transcript: ENSMUST00000100726
Sequence length 1078
Comment pep:known chromosome:NCBIM37:15:32347114:32626085:1 gene:ENSMUSG00000022231 transcript:ENSMUST00000100726
Sequence
MKGACILAWLFSSLGVWRLARPETQDPAKCQRAEHPVVSYKEIGPWLREFRAENAVDFSR
LTFDPGQKELVVGARNYLFRLELEDLSLIQAVEWECDEATKKACYSKGKSKEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTIRSLSNLTEIHDQISGMARCPYSPQHNSTALLTASGELY
AATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQGTFFLPEL
DLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTM
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDNSRFSHLAVDVVQGRETLVHII
YLATDYGTIKKVRAPLSQSSGSCLLEEIELFPERRSEPIRSLQILHSQSVLFVGLQEHVA
KIPLKRCHFHQTRSACIGAQDPYCGWDAVMKKCTSLEESLSMTQWDQSIPTCPTRNLTVD
GSFGPWSPWTPCTHTDGTAVGSCLCRSRSCDSPAPQCGGWQCEGPRMEITNCSRNGGWTP
WTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHVFWTGWG
PWERCTAQCGGGIQARRRTCENGPDCAGCNVEYQPCNTNACPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKFGGMPCLGPSLEFQECNILPCPV
DGVWSCWSSWSKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQTCPESWS
EWSDWSVCDASGTQVRARQCILLFPVGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEE
KRCGGEFNKFNMFHMMAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAALNS
SITNHINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
Download sequence
Identical sequences ENSMUSP00000098292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]