SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101353 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101353
Domain Number 1 Region: 424-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 480-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 340-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 284-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 564-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 43-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-20
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 7 Region: 605-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 230-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000605
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 526-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000817
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 10 Region: 386-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000115
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101353   Gene: ENSMUSG00000066009   Transcript: ENSMUST00000105728
Sequence length 668
Comment pep:novel chromosome:NCBIM37:4:146069050:146094022:1 gene:ENSMUSG00000066009 transcript:ENSMUST00000105728
Sequence
MTTIFSLHVSDLDVKFQEEFKLCSSLDPGRRTTTRMSVCLVNTPQGLLTFKDVALDFSLE
EWECLSFAQRSLYMDVMLENYNNLLFVENHCIRGKNGKVLDQDSQYIVHEHMNIQEKSSK
WDKLSNVILESLQCTPYKTNHSSDALQFSNQKRLKPRNTKEVCKYNDSVNSLSLFSTISL
NQGINMQKKKHNRNAELDKIFVSKHKVMVKKDNIAGNPYKCSEFHKYLTQRENLQSQQRI
YHGKKPYKSSKSDKCFTHQIHLSIHQEIHTEEKIYKCSECDKCFKNKFNLTMHQRIHTGE
KPYKCSECDKCFTKQSNLSIHQRIHTGEKPYKCSECDKCFTQESYLSIHQRIHTGEKPYK
CSECGKCFTEKSSLRIHQRIHTGEKPYKCSECDKCFTQQSHLSIHQRIHTGEKPYKCSEC
DKCFTQQSNLSIHQRIHTGEKPYKCSECGKCFTEKSSLRIHQRIHTGEKPYKCSECGKCF
TEKSSLRIHQRIHTGEKPYKCNECGKCFTEKSSLRIHQRIHTGEKPYKCSECGKCFTVKS
SLRIHQKIHTGEKPYKCSECDKCFTKPSHLSIHQRIHTGEKPYKCSECEKCFNEKNILKI
HQRIHTGERPYKCSECDKCFSRKFHLGIHQRIHTGKKPYKCSECDKCFTQKSHLSIHQKI
HTGEKPYK
Download sequence
Identical sequences 10090.ENSMUSP00000101354 ENSMUSP00000101353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]