SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101887 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101887
Domain Number 1 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 126-188
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 322-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.22e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 514-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101887   Gene: ENSMUSG00000064141   Transcript: ENSMUST00000106280
Sequence length 587
Comment pep:known chromosome:NCBIM37:4:120602742:120624304:-1 gene:ENSMUSG00000064141 transcript:ENSMUST00000106280
Sequence
MPQQLLITPATEATWVKLKEVSLWEDVTKMFGGEALLSHDANGTQQESLADGTTPGTPAA
GSHDGATPGTTATGSHDEATPGTPAAGSHDGETPGIPAAGSHDGETPGTPTAGSHDGVTP
GTTAAGSQESLTFKDIAVDLSQEEWGQLAPAYQDLYREVMLENYRNLVSVAGYQLSKPTV
ISQLEKGEGPCMAESQGPEDPILDVKNKLETKESTAEDDISVKLDHGITRGRLIEDDIVC
SPLKKASSYSDTLESHRATCGKGTRRAIWTHKKKRQEGNKLENPESSNVILEQKHRKHKP
ARKRNKYKLDSIDHPVSCMRARRYPCNVCEKMFKQPIHLVEHMRTHTGEKPFRCKECGRA
FSQSASLNTHQRIHTGEKPFACEECGKAFRHRSSLNQHHRTHTGEKPFTCDKCQKAFSQN
ISLVQHLRTHSGEKPFSCSECGKPFRQIRHLSEHVRIHTGEKPYKCTSCCKTFSHRAYLT
HHQRIHTGERPYKCKECGKAFRQRIHLSNHRTVHTGVKAYECNRCGKAYRHDSSFKKHQR
HHTGEKPYECTECGKSFSYNSSLSRHQKIHRRNTFRDDPGHENKRQL
Download sequence
Identical sequences A2A761
ENSMUSP00000101887 ENSMUSP00000101887 ENSMUSP00000101888 10090.ENSMUSP00000101887 ENSMUSP00000101887 NP_001005788.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]