SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105708 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105708
Domain Number 1 Region: 365-459
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 7.32e-36
Family Small-conductance potassium channel 0.00000645
Further Details:      
 
Domain Number 2 Region: 234-407
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.35e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000105708
Domain Number - Region: 438-521
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.00942
Family Outer membrane efflux proteins (OEP) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105708   Gene: ENSMUSG00000002908   Transcript: ENSMUST00000110081
Sequence length 538
Comment pep:known chromosome:NCBIM37:8:73365948:73380907:-1 gene:ENSMUSG00000002908 transcript:ENSMUST00000110081
Sequence
MSSHSHNGSVGQPLGSGPGFLGWEPVDPEAGRPLQPTQGPGLQMVAKGQPVRLSPGGSRG
HPQEQEEEEEEEEEEEDKTGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMV
TETELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMT
WERVSLISLELVVCAIHPVPGHYRFTWTARLAFSLVPSAAEADLDVLLSIPMFLRLYLLA
RVMLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSVSSWIVAAWTVR
VCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVV
AVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRK
HQRKFLQAIHQAQKLRSVKIEQGKVNDQANTLAELAKAQSIAYEVVSELQAQQEELEARL
AALESRLDVLGASLQALPGLIAQAICPLPPPWPGPGHLATATQSPQSHWLPTMGSDCG
Download sequence
Identical sequences A0A140T8Q8
ENSMUSP00000105708 NP_115773.2.92730 XP_006509870.1.92730 XP_006509871.1.92730 ENSMUSP00000105705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]