SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000110748 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000110748
Domain Number 1 Region: 41-506
Classification Level Classification E-value
Superfamily Sema domain 1.12e-130
Family Sema domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 1351-1478,1674-1863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.68e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 952-1038
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000178
Family Other IPT/TIG domains 0.075
Further Details:      
 
Domain Number 4 Region: 857-951
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000243
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 5 Region: 1036-1140
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 509-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000876
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 7 Region: 1137-1226
Classification Level Classification E-value
Superfamily E set domains 0.000000336
Family Other IPT/TIG domains 0.08
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000110748
Domain Number - Region: 808-841
Classification Level Classification E-value
Superfamily Plexin repeat 0.000102
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number - Region: 653-685
Classification Level Classification E-value
Superfamily Plexin repeat 0.0392
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000110748   Gene: ENSMUSG00000029765   Transcript: ENSMUST00000115096
Sequence length 1893
Comment pep:known chromosome:NCBIM37:6:32095926:32538192:-1 gene:ENSMUSG00000029765 transcript:ENSMUST00000115096
Sequence
MKAMPWNWTCLLSHLLVVGMGSSTLLPRQPPQLSQKPSFVTFRGEPAEGFNHLVVDERTG
HIYLGAVNRIYKLSSDLKVLVTHQTGPDEDNPKCYPPRIVQTCNEPLASTNNVNKMLLID
YKENRLIACGSLYQGICKLLRLEDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYSNFDD
KLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTVIPDFD
IYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCE
RNGVEYRLLQAAYLSKAGAVLGRTLGVRPDDDLLFTVFSKGQKRKMKSLDESALCIFILK
QINDRIKDRLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSEMVRG
IPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPKGNALQYETVQVVDSGPV
LRDMAFSKDHEQLYIMSERQLTRVPVESCGQYRSCGECLGSGDPHCGWCVLHNTCTRKER
CERSREPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEM
DGLVIGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNS
CLSCVESPYRCHWCKYRHVCTHDPNTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPIT
LKAKNLPQPQSGQRGYECILNIQGIEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVEL
TVVWNGHFNIDNPAQNKVYLYKCGAMRESCGLCLKADPDFECGWCQSPGQCTLRQHCPAH
ESRWLELSGANSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVEC
SPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLADLKP
NRGPMSGGTQVTITGTNLNAGSNVVVMFGSQPCLFHRRSPSYIICNTTSSEEVLDMKVTV
QVDRARIRQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKE
HINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPN
PVFEAFSPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLLC
ESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAYK
RKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYT
MRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMR
DRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNW
FTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLV
LSCVSPDNVNSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGA
RMILQDEDITTKIENDWKRLNTVAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASKY
ENMIRYTGSPDSLRSRTPMITPDLESGVKLWHLVKNHEHGDQKEGDRGSKMVSEIYLTRL
LATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSN
CLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYA
KDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKYS
EEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences Q80UG2
NP_786926.2.92730 ENSMUSP00000110748 ENSMUSP00000110748 ENSMUSP00000110748 10090.ENSMUSP00000110748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]