SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000112723 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000112723
Domain Number 1 Region: 246-448
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.65e-47
Family Reprolysin-like 0.0027
Further Details:      
 
Domain Number 2 Region: 542-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000719
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 961-1011
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000693
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 892-958
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000876
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 838-896
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000144
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000112723   Gene: ENSMUSG00000059901   Transcript: ENSMUST00000120336
Sequence length 1209
Comment pep:novel chromosome:NCBIM37:10:60661216:60735990:-1 gene:ENSMUSG00000059901 transcript:ENSMUST00000120336
Sequence
MAWLRALLHCLLPWYCALCAAAGSQTPDLRLSGKLHDYVVTVPCSTDFQGRFLSHVVSAP
AAPSPRSHLRVARSPLSLERETPRPGGPRQHFLYFNVTVFGKLLHLRLQPNRRLVAPGAP
VEWQEDFRELFRQPLQQECVYTGGVTGMPGAAVAISNCDGLAGLIRTDNSDYFIEPLERG
QQEKEAGGRTHVVYRREAVQREWKEPHGDLHNEAFGLGDLPNVLDLVGDRLGDAERKRRH
AKPGSYSIEVLLAVDDSVVRFHGREHTQNYVLTLMNIVDEIYHDESLGAHVNIALVRLIM
VGYRQSLSLIERGNPARSLEQVCRWAHSQQRQDPSHTEHHDHVIFLTRQNFGPSGMQGYA
PVTGMCHPLRSCALNHEDGFSSAFVVAHETGHVLGMEHDGQGNGCDDETSLGSVMAPLVQ
AAFHRFHWSRCSKLELSRYLPSYDCLLDDPFERTWPQPPELPGIDYSMDEQCRFDFGTGY
HTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHCIWKSPEQTYG
QDGGWSSWTNFGSCSRSCGGGVRSRSRSCDNPPPAYGGRPCSGSMFEYQICNSEDCPGPY
EDFRAQQCAKRNSYYTHQDAKHSWLPYEPDSDAQKCELICQSADTGDVVFMNQVVHDGTR
CSYRDPYSVCARGECVPFGCDKEVGSMKTDDKCGVCGGDNSHCRTVKGTLGKGSKQAAAL
KQVQIPAGARHIQIELLEKAPHRIAVKNQVTGSFIFNPKGKEASSRTFTALGLEWEHEAE
DTKDSLRTNGPLPEAIAILVLPPAEGKPRGSLAYKYVIHEDLLPLIGSNNVLLEETDTYE
WALKSWSPCSKACGGGIQFTKYGCRRRRDHHMVHRHLCDHKKRPKPIRRRCNQHSCPQPT
WVTEEWGACSRSCGKLGLQTRGVQCLLPLSNGTHKAMPAKACLGNRPEAKKPCLRVPCPA
QWRTGAWSQCSATCGEGIQQRQVVCRNTSSALGPCEGVKPDMVQICSLPACGGDLQNSTV
KAEVQDPVTKTGYREPQSRPLTPEDRISTMEPCVRDRSVFCRMEVLDRYCTIPGYHRLCC
ESCIKKTSGPNASLALPPTFSTPGSLLPAPKATLEDVKSTRGPTSLEDHRQSQPTQLPDV
ADRISPVTQYPVTPQMLSPKAFPGNSPATPRRPPQDWTQTAMPTSEGQGQSREEPGHGGT
SLPATSPVT
Download sequence
Identical sequences E9PX39
ENSMUSP00000112723 10090.ENSMUSP00000112723 ENSMUSP00000112723 ENSMUSP00000112723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]