SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000113475 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000113475
Domain Number 1 Region: 238-910
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.98e-244
Family Neutral endopeptidase (neprilysin) 0.00000000037
Further Details:      
 
Domain Number 2 Region: 18-140
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.31e-20
Family TehB-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000113475   Gene: ENSMUSG00000022842   Transcript: ENSMUST00000120394
Sequence length 910
Comment pep:known chromosome:NCBIM37:16:20611683:20645993:1 gene:ENSMUSG00000022842 transcript:ENSMUST00000120394
Sequence
MASPRTPVSPPELPEKNFQYRQVQYWDQRYKDAADSGPYEWFGDFASFRALLEPELCPED
RILVLGCGNSALSYELFLGGFPNVTSVDYSPVVVAAMQVRYAHVPSLRWETMDVRALDFP
SGSFDVVLEKGTLDAMLAGEPDPWNVSSEGVHTVDQVLSEMVEYKRAKLRDEESPEITVE
GRATRDSLEVGFQKRTRQLFGSHTQLELVLAGLILVLAALLLGCLVALWVHRDPAHSTCV
TEACIRVAGKILESLDRGVSPCQDFYQFSCGGWIRRNPLPNGRSRWNTFNSLWDQNQAIL
KHLLENTTFNSSSEAERKTRSFYLSCLQSERIEKLGAKPLRDLIDKIGGWNITGPWDEDS
FMDVLKAVAGTYRATPFFTVYVSADSKSSNSNIIQVDQSGLFLPSRDYYLNRTANEKVLT
AYLDYMVELGVLLGGQPTSTREQMQQVLELEIQLANITVPQDQRRDEEKIYHKMSISELQ
ALAPAVDWLEFLSFLLSPLELGDSEPVVVYGTEYLQQVSELINRTEPSILNNYLIWNLVQ
KTTSSLDQRFETAQEKLLETLYGTKKSCTPRWQTCISNTDDALGFALGSLFVKATFDRQS
KEIAEGMINEIRSAFEETLGDLVWMDEKTRLAAKEKADAIYDMIGFPDFILEPKELDDVY
DGYEVSEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPA
GILQAPFYAHNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLTAFQN
HTACMEEQYSQYQVNGERLNGLQTLGENIADNGGLKAAYNAYKAWLRKHGEEQPLPAVGL
TNHQLFFVGFAQVWCSVRTPESSHEGLVTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSP
MNPGQLCEVW
Download sequence
Identical sequences ENSMUSP00000113475 NP_808810.1.92730 ENSMUSP00000111184 10090.ENSMUSP00000113475 ENSMUSP00000113475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]