SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000114273 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000114273
Domain Number 1 Region: 179-560
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.85e-101
Family Phosphonoacetate hydrolase 0.02
Further Details:      
 
Domain Number 2 Region: 632-889
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.24e-21
Family DNA/RNA non-specific endonuclease 0.012
Further Details:      
 
Domain Number 3 Region: 87-132
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000549
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 133-174
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000116
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000114273   Gene: ENSMUSG00000037370   Transcript: ENSMUST00000135846
Sequence length 906
Comment pep:known chromosome:NCBIM37:10:24361612:24431797:-1 gene:ENSMUSG00000037370 transcript:ENSMUST00000135846
Sequence
MERDGDQAGHGPRHGSAGNGRELESPAAASLLAPMDLGEEPLEKAERARPAKDPNTYKVL
SLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFSNCRCDAACVSLGNCCLDFQE
TCVEPTHIWTCNKFRCGEKRLSRFVCSCADDCKTHNDCCINYSSVCQDKKSWVEETCESI
DTPECPAEFESPPTLLFSLDGFRAEYLHTWGGLLPVISKLKNCGTYTKNMRPMYPTKTFP
NHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPLWYKGQPIWVTANHQEVKSG
TYFWPGSDVEIDGILPDIYKVYNGSVPFEERILAVLEWLQLPSHERPHFYTLYLEEPDSS
GHSHGPVSSEVIKALQKVDRLVGMLMDGLKDLGLDKCLNLILISDHGMEQGSCKKYVYLN
KYLGDVNNVKVVYGPAARLRPTDVPETYYSFNYEALAKNLSCREPNQHFRPYLKPFLPKR
LHFAKSDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNLFSNMQALFIGYGPAFKHG
AEVDSFENIEVYNLMCDLLGLIPAPNNGSHGSLNHLLKKPIYNPSHPKEEGFLSQCPIKS
TSNDLGCTCDPWIVPIKDFEKQLNLTTEDVDDIYHMTVPYGRPRILLKQHRVCLLQQQQF
LTGYSLDLLMPLWASYTFLSNDQFSRDDFSNCLYQDLRIPLSPVHKCSYYKSNSKLSYGF
LTPPRLNRVSNHIYSEALLTSNIVPMYQSFQVIWHYLHDTLLQRYAHERNGINVVSGPVF
DFDYDGRYDSLEILKQNSRVIRSQEILIPTHFFIVLTSCKQLSETPLECSALESSAYILP
HRPDNIESCTHGKRESSWVEELLTLHRARVTDVELITGLSFYQDRQESVSELLRLKTHLP
IFSQED
Download sequence
Identical sequences A0A0R4J1Q7
NP_001295256.1.92730 10090.ENSMUSP00000114273 ENSMUSP00000114273 ENSMUSP00000114273 ENSMUSP00000114273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]