SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000118464 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000118464
Domain Number 1 Region: 25-87
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000189
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000118464   Gene: ENSMUSG00000048652   Transcript: ENSMUST00000124931
Sequence length 102
Comment pep:novel chromosome:NCBIM37:3:146309056:146345374:-1 gene:ENSMUSG00000048652 transcript:ENSMUST00000124931
Sequence
MLSVDMDNKGNGPVGVKNSMENGRPPDPADWAVTDVVNYFRTAGFEEQACAFQEQEIDGK
SLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS
Download sequence
Identical sequences D3YUG0
ENSMUSP00000118464 XP_011238565.1.92730 XP_011238566.1.92730 XP_011238567.1.92730 XP_011238568.1.92730 ENSMUSP00000118464 ENSMUSP00000118934 ENSMUSP00000119608 ENSMUSP00000118464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]