SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000124518 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000124518
Domain Number 1 Region: 24-212
Classification Level Classification E-value
Superfamily Cupredoxins 9.13e-58
Family Multidomain cupredoxins 0.0000024
Further Details:      
 
Domain Number 2 Region: 376-571
Classification Level Classification E-value
Superfamily Cupredoxins 1.41e-53
Family Multidomain cupredoxins 0.00000406
Further Details:      
 
Domain Number 3 Region: 221-365
Classification Level Classification E-value
Superfamily Cupredoxins 4.29e-49
Family Multidomain cupredoxins 0.00000959
Further Details:      
 
Domain Number 4 Region: 729-913
Classification Level Classification E-value
Superfamily Cupredoxins 2.24e-46
Family Multidomain cupredoxins 0.00000639
Further Details:      
 
Domain Number 5 Region: 920-1066
Classification Level Classification E-value
Superfamily Cupredoxins 3.06e-45
Family Multidomain cupredoxins 0.00000486
Further Details:      
 
Domain Number 6 Region: 574-718
Classification Level Classification E-value
Superfamily Cupredoxins 4.19e-42
Family Multidomain cupredoxins 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000124518   Gene: ENSMUSG00000031936   Transcript: ENSMUST00000159985
Sequence length 1159
Comment pep:novel chromosome:NCBIM37:9:14856285:14916552:-1 gene:ENSMUSG00000031936 transcript:ENSMUST00000159985
Sequence
MFLKQPGGCILLQFLGLLGLVGAVTRTYYIGIVEEYWNYVPQGKDVITGKSFSEDKLATL
FLERGPNRIGGIYKKAVYRHFTDGSYSTEIPKPPWLGFLGPILRAEVGDVIVIHLMNFAS
RPFSLHPHGVFYDKDSEGALYPDGTSGRNKEDDMVPPGKNYTYVWPVREEYAPAPADANC
LTWVYHSHIDAPKDICSGLIGPLLVCKEGVLNRYSGMRTDVDREFVIMFTLVDENQSWYL
DDNIKQFCTNPNSVDKSDAVFQRSNKMHALNGFLFGNMPEPEMCVGESVSWHLFGMGNEI
DIHSIYFYGNTFITRGHRADVVNLFPATFLTTEMIVENPGKWMITCQVSDHLQAGMLGQY
SVGNCRGNAPHPKVQGQQRRYFIAAEKVLWDYGPQGYDKFTGFPLNTSGSDSAVYFTQAD
NRIGGKYWKARYTEYVDATFSRRKMPSDSEAHLGILGPVIKAEVGDILLVTFANKADKVY
SILPHGVFYDKASDAAPNVDGFLKPGAHVKPGETFTYRWTVPESVSPTDEDPPCLTYLYF
SAVQPIKDTSAGLVGPLLVCKKGTLNADGTQKGIDKEFYLLFTVFDENFSSYLDENIKKF
TWHPFSVDKEDKEFVKSNRMHAVNGYMYGSQPGLSMCKKDRVSWHLIGMGTDTDMHGVYF
QGNTIHLRGTHRDSLALFPHMATTAYMQPDHSGIFKVFCSTLPHFTRGMGQIYEISSCGN
RDPSEPPYGMLRTFFIAAEEVEWDYAPNKNWEFEKQHLDAGGERHGDIFMNHTENWIGSQ
YRKVVYREYTNGEFVEIKARPPQEEHLQLLGPMIHAEVGDSILIIFKNKASRPYSIAAQG
VEDSNNGKLLNVPVTKPGEIKTYRWNVPKRSGPGPSDPNCIPWVYFSTANFVKDTYSGLM
GPLITCREGVLNEKGRRSDVDYEFALLFLVFNENESWYLDDNIKKYLNKDPRDFKHTDDF
EESNKMHAINGKIFGNLPGLIMTEDSMTNWYLLGIGSEVDIHTIHYHAESFLFKIDKSYR
EDVYDLFPGTFQTIELFADHPGTWLLHCHVSDHIHAGMETTYTVLRNIDNRIPYSTKTPS
GAGSHAVTVPSQEQPGKEELYFFGKNLRPRGAKAALVILFILGLLLLVATVVLALRLRSS
RRQMAYREVQSCALPTDAL
Download sequence
Identical sequences Q3V1H3
NP_001158269.1.92730 ENSMUSP00000124518 ENSMUSP00000124518 ENSMUSP00000124518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]