SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131104 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131104
Domain Number 1 Region: 853-931
Classification Level Classification E-value
Superfamily DEATH domain 3.7e-19
Family DEATH domain, DD 0.0000616
Further Details:      
 
Domain Number 2 Region: 159-250
Classification Level Classification E-value
Superfamily Immunoglobulin 6.31e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 249-299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000366
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 305-352
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 52-154
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000152
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131104   Gene: ENSMUSG00000063626   Transcript: ENSMUST00000166334
Sequence length 956
Comment pep:known chromosome:NCBIM37:8:29758365:30329810:-1 gene:ENSMUSG00000063626 transcript:ENSMUST00000166334
Sequence
MGTGAADGSRGARRWLPWLGLFFWAAGAAAARGADGSEILPDSIPSAPGTLPHFIEEPED
AYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTRQQ
VEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRP
PEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRS
LSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCT
ALCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILD
KKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSHSDYGVDVIDS
SALTGGFQTFNFKTVRQGNSLLLNPAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNP
LSDIKVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNNRGFSTIHPRNKTPYIQNLSSLP
TRTELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEV
LLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSC
YCLLDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTP
CAFQEVISDERHQGGQLLEEPKLLHFKGNTFSLQVSVLDIPPFLWRIKPFTACQEVPFSR
VWSSNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQ
EDSTFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSP
SAVILNLWEARHQQDGDLDSLACALEEIGRTHTKLSNITEPQIDDADFNYSRQNGL
Download sequence
Identical sequences Q8K1S2
10090.ENSMUSP00000077670 ENSMUSP00000128521 ENSMUSP00000128521 NYSGRC-IgSF-Q8K1S2 NP_694775.1.92730 ENSMUSP00000131104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]