SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132219 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132219
Domain Number 1 Region: 256-458
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.32e-47
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 550-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000706
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 970-1016
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000942
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 908-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 847-905
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132219   Gene: ENSMUSG00000043635   Transcript: ENSMUST00000163159
Sequence length 1204
Comment pep:known chromosome:NCBIM37:5:90102866:90312359:-1 gene:ENSMUSG00000043635 transcript:ENSMUST00000163159
Sequence
MVFLSLWLIAASLVEVRTSADGQAGTDEMVQIDLPTKRYREYELVTPVSTNLKGHYLSHI
LSANHKKRSPRDVSSNSEHLFFNVTAFGRDFHLRLKPNTHFIAPGAVVEWHETAPRPGNT
TDPRNSHLHGSASEGSWRSEPLQTSCAYVGDIMDIPGTSVAISNCDGLAGMIKSDDEEYF
IEPLERGKQMDEENGRIHVVYKRSAVEQPPRDVSEDVYHRESDLEGLDDLGTVYSNIGQQ
LNKTMRRRRHTGENDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVH
INVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWACQQQKTDPNHAEHHDHAIFLTRQD
FGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETA
MGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFEHDWPKLPELPGINYSMDE
QCRFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHC
MWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPTPINGGQDCPGVNFEYQLC
NTEECQKHFEDFRAQQCQQRNSHFDYQNTKHHWLPHEHPDSKKRCHLYCQSKETGDVAYM
KQLVHDGTRCSYKDPYSICVRGECVKVGCDREIGSNKVEDKCGVCGGDNSHCRTVKGTFT
RTPRKLGKTRGAFVLPKGARNISLAETRETKNVLAIKNQATGHYILNGKGEEAKSRTFID
LGVEWDYNIEDDIETLHTDGPLHDPVIVLIIPQENDTRSSLTYKYIIHEDSVPTINSNNV
IQEELDTFEWALKSWSQCSEPCGGGFQYTKYGCRRKSDSKMVHRSFCEVNKKPKPIRRMC
NIQECTHPVWAADEWEHCSRSCGSSGNQLRTVRCLQPLQDGTNRSVHSKYCLGDRPESRR
PCNRVPCPAQWKTGSWNECSVTCGEGTEVRQVLCRTGDHCDGEKPESVRPCQLPPCNDEP
CLGDKSIFCQMEVLARYCSIPGYNKLCCESCSKRSGTLPPPYLQEAAEIHSDAIFGPSDL
PRSLVMPTPFLPSSSGTRAEKKSLSSFSSMANPNADAAFRASSRASADFPRKRAHQAGRK
TLESVPSSSSIKTDHLRPASPVAAAPSPAISDSIGASPQTRTPKKDDAKSVSRRHPTRST
ASER
Download sequence
Identical sequences E9Q287
ENSMUSP00000132219 ENSMUSP00000132219 NP_808540.2.92730 ENSMUSP00000132219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]