SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133166 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133166
Domain Number 1 Region: 249-524
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.86e-82
Family Leukotriene A4 hydrolase catalytic domain 0.00053
Further Details:      
 
Domain Number 2 Region: 35-242
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 4.45e-54
Family Leukotriene A4 hydrolase N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133166   Gene: ENSMUSG00000021583   Transcript: ENSMUST00000169114
Sequence length 930
Comment pep:known chromosome:NCBIM37:13:74777320:74829323:1 gene:ENSMUSG00000021583 transcript:ENSMUST00000169114
Sequence
MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPEYMTPIHYDLMIHANL
STLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEMLSEEPLKVLEYPAHEQV
ALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEMRILAATQFEPTAARMAF
PCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIEDHFDITVKMSTYLVAFII
SDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFNIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIVSHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEVDALNSSHPVSTPVENPAQIRE
MFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYSYKNTKNEDLWNSMMHICPTDGT
QTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQKGFPLITITVSGRNVHMKQEHYMK
GSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTDVLILPEAVQWIKFNVGMNGYYIVH
YADDGWASLSGLLKEAHTTISSNDRASLINNAFQLVSIEKLSIEKALDLTLYLKNETEIM
PIFQALNELIPMYKLMEKRDMIEVETQFKDFLLKLLKDLIDKQTWTDEGSVSERMLRSQL
LLLACVRNYQPCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQS
SLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWK
FLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQT
IETIEENIRWMDKNFDKIRLWLQKEKPELL
Download sequence
Identical sequences Q9EQH2
ENSMUSP00000133166 ENSMUSP00000133166 NP_109636.1.92730 XP_006517539.1.92730 10090.ENSMUSP00000022070 ENSMUSP00000133166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]