SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133212 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133212
Domain Number 1 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-16
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 90-151
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000305
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 286-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000281
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133212   Gene: ENSMUSG00000022987   Transcript: ENSMUST00000169721
Sequence length 422
Comment pep:known chromosome:NCBIM37:15:98116553:98126514:-1 gene:ENSMUSG00000022987 transcript:ENSMUST00000169721
Sequence
MLSEQAVGLGTGWEPMNTQLDAAELQSERGTREEGSWRTAPRPLEHLHCGLEDEPLSLQE
KATSVPWVPAVPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFY
GEYVMQENCGIVVSLRFPIPKLDMLSQQEGGEDQWAPDPQDVEGRDILKVTYTGDGGEPQ
GDTPELQVEPPRTLSSVTEDTALWNPGQGPSWESMPRNSTGMLLSPRFLQEDTFSRHLHR
TDTDSLLKPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGRRHHLIRHQKTH
LHDKPSRCSECGKSFRCSSHLASHQRVHADSKSCKGQDFGESPAAQHCVPPVPKCHVCTE
CGKSFGRRHHLVRHWLTHTGEKPFHCPRCEKSFGRKHHLDRHLLTHQGQSPGSSWDRRTA
AF
Download sequence
Identical sequences Q8BZ34
ENSMUSP00000023722 ENSMUSP00000133212 ENSMUSP00000133212 10090.ENSMUSP00000023722 NP_776130.1.92730 XP_006521032.1.92730 XP_006521033.1.92730 XP_011243929.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]