SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001166 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001166
Domain Number 1 Region: 314-451
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000314
Family CBS-domain pair 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000001166
Domain Number - Region: 547-598,629-655
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000126
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001166   Gene: ENSMUSG00000001138   Transcript: ENSMUST00000001166
Sequence length 713
Comment pep:known chromosome:GRCm38:1:36511867:36528237:1 gene:ENSMUSG00000001138 transcript:ENSMUST00000001166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAVVGWLGWVLAAFCLGSTAGEAAPAPGAGLLNFCTEEDSAPGAGSLRGRAAPEA
TLCLRLFCSGLANSSWTWVAAEGAGCPEGGRATEPEEAAAPTGEWRALLRLRAEAGHPRS
ALLAVRVEPGGGAAEEAAPPWALGLGAAGLLALAAVARGLQLSALALAPAEVQVLRESGS
EAERAAARRLEPARRWAGCALGALLLLASLAQAALAVLLYGAAGQRAVPAVLGCAGLVFL
VGEVLPAAVSGRWALALAPRALGLSRLAVLLTLPVALPVGQLLELAARPGRLRERVLELA
RGGGDPYSDLSKGVLRSRTVEDVLTPLEDCFMLDSGTVLDFSVLASIMQSGHTRIPVYEE
ERSNIVDMLYLKDLAIVEPEDCTPLSTITRFYNHPLHFVFNDTKLDAVLEEFKRGKSHLA
IVQKVNNEGEGDPFYEVLGLVTLEDVIEEIIKSEILDESEDYSDTKVRKKTVALGAPLKR
KEEFSLFKVSDDEYKVKISPQLLLATQRFLSREVDVFSPLRVSEKVLLHLLKHPSVNQEV
TFDESNRLAAHHYLYQRSQPVDYFILILQGRVEVEIGKEGLKFENGAFTYYGVSALTAPS
SAHQSPVSSRQLIRHDVQPEPADGTRSCTYCPDYTVRALSDLQLIKVTRLQYLNALLATR
AQSLPPSPENAELQAIPGSQTRLLGDKSRETAGSTNSRPSIPVEESPGRNPGV
Download sequence
Identical sequences Q32NY4
NP_444416.2.92730 ENSMUSP00000001166 ENSMUSP00000001166 ENSMUSP00000001166 10090.ENSMUSP00000001166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]