SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001319 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001319
Domain Number 1 Region: 33-169
Classification Level Classification E-value
Superfamily Cupredoxins 1.76e-53
Family Ephrin ectodomain 0.000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001319   Gene: ENSMUSG00000001300   Transcript: ENSMUST00000001319
Sequence length 336
Comment pep:known chromosome:GRCm38:8:8617434:8660773:-1 gene:ENSMUSG00000001300 transcript:ENSMUST00000001319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMARSRRDSVWKYCWGLLMVLCRTAISRSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDK
LDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEF
SPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNH
GPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFAGIASGCII
FIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRGGNNNGSEPSDVIIPLRTAD
SVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Download sequence
Identical sequences P52800 Q4FJM3
ENSMUSP00000001319 NP_034241.2.92730 ENSMUSP00000001319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]