SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000003154 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000003154
Domain Number 1 Region: 30-171
Classification Level Classification E-value
Superfamily Cupredoxins 3.95e-47
Family Ephrin ectodomain 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000003154   Gene: ENSMUSG00000003070   Transcript: ENSMUST00000003154
Sequence length 209
Comment pep:known chromosome:GRCm38:10:80179482:80190010:1 gene:ENSMUSG00000003070 transcript:ENSMUST00000003154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAQRPLLPLLLLLLPLRARNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVS
INDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPL
KFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPI
FTSNSSCSGLGGCHLFLTTVPVLWSLLGS
Download sequence
Identical sequences F1MA19 P52801
ENSMUSP00000003154 ENSRNOP00000021709 ENSMUSP00000003154 ENSMUSP00000003154 10090.ENSMUSP00000003154 10116.ENSRNOP00000021709 NP_001162141.1.100692 NP_001162141.1.4139 NP_031935.3.92730 ENSRNOP00000021709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]