SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000005953 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000005953
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000005953   Gene: ENSMUSG00000005803   Transcript: ENSMUST00000005953
Sequence length 450
Comment pep:known chromosome:GRCm38:2:122765237:122809569:1 gene:ENSMUSG00000005803 transcript:ENSMUST00000005953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLVTVVSSPRARLFACFLRLGTQQAGPLQLHTGACCTAKNHYEVLVLGGGAGGITMAT
RMKRRVGAENVAIVEPSERHFYQPIWTLVGAGAKELSLSVRSTLSVIPSGVQWIQDRVAE
LNPDENCIRTDSGKEISYRYLIIALGIQLDYEKIKGLPEGFAYPKIGSNYSVKTVEKTWK
ALQGFKEGNALFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRPKANIIFNTALGTIFGVK
KYADALQEIIRERDVSVNYKHNLIEVRPDKQEAVFEILDKPGETHVIPYEMLHVTPPMSA
PDVLKRSPVADSAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTM
CLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERITMYLMKAD
MMPFLYWNMMLRGYWGGPAFLRKLFHLGMN
Download sequence
Identical sequences Q9R112
ENSMUSP00000005953 ENSMUSP00000106133 ENSMUSP00000005953 ENSMUSP00000005953 NP_001155975.1.92730 NP_067482.4.92730 XP_006500029.1.92730 10090.ENSMUSP00000106133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]