SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000006303 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000006303
Domain Number 1 Region: 40-109
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 0.000012
Family CCP-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000006303   Gene: ENSMUSG00000006143   Transcript: ENSMUST00000006303
Sequence length 250
Comment pep:known chromosome:GRCm38:5:136057267:136064326:1 gene:ENSMUSG00000006143 transcript:ENSMUST00000006303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPHGKQSVLRMPLLLLLTCVQSGTGLESINYAPQLLGATLEGRLTQSTFTLEQPLGQFK
NVNLSDPDPIWLVVAHSNAAQNFTAPRKVEDRHAPANFDRNGYYLTLRANRVHYKGGQPD
SQLRVLRVGNDNNCSLESQGCNSPLPGAGPYRVKFLAMSAEGPVAETLWSEEIYLQQAQT
FREAPGSQGKGTVVIIAFLSILLAILLVVFLVLVISACSLSTSGSSPEEQVRMRHYHTHH
MGSLRAERSS
Download sequence
Identical sequences F8WJ60
NP_081434.1.92730 ENSMUSP00000006303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]