SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000006452 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000006452
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.47e-26
Family YeaZ-like 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000006452
Domain Number - Region: 100-172
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.000117
Family BadF/BadG/BcrA/BcrD-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000006452   Gene: ENSMUSG00000006289   Transcript: ENSMUST00000006452
Sequence length 186
Comment pep:known chromosome:GRCm38:14:50915682:50924830:-1 gene:ENSMUSG00000006289 transcript:ENSMUST00000006452 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MPAVLGFEGSANKIGVGVVRDGTVLANPRRTYVTAPGTGFLPGDTARHHRAVILDLLQEA
LTEAGLTSKDIDCIAFTKGPGMGSPLASVAVVARTVAQLWNKPLLGVNHCIGHIEMGRLI
TGAVNPTVLYVSGGNTQVISYSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNI
EQMAKR
Download sequence
Identical sequences E9QMF4
ENSMUSP00000006452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]