SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000007259 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000007259
Domain Number 1 Region: 20-110
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000291
Family Snake venom toxins 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000007259   Gene: ENSMUSG00000073413   Transcript: ENSMUST00000007259
Sequence length 135
Comment pep:known chromosome:GRCm38:17:35071443:35074500:-1 gene:ENSMUSG00000073413 transcript:ENSMUST00000007259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSQLVGILLSALLGVALGHRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSE
QAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCNSAVASSVTPLCI
LAAAVTTLAWLLPGL
Download sequence
Identical sequences Q9Z1Q3
ENSMUSP00000007259 10090.ENSMUSP00000007259 ENSMUSP00000007259 NP_258439.1.92730 ENSMUSP00000007259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]