SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000015394 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000015394
Domain Number 1 Region: 279-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.19e-68
Family Hemopexin-like domain 0.00000000736
Further Details:      
 
Domain Number 2 Region: 107-270
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.39e-60
Family Matrix metalloproteases, catalytic domain 0.000000035
Further Details:      
 
Domain Number 3 Region: 30-102
Classification Level Classification E-value
Superfamily PGBD-like 2.04e-18
Family MMP N-terminal domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000015394   Gene: ENSMUSG00000050578   Transcript: ENSMUST00000015394
Sequence length 472
Comment pep:known chromosome:GRCm38:9:7272514:7283333:1 gene:ENSMUSG00000050578 transcript:ENSMUST00000015394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSAILATFFLLSWTPCWSLPLPYGDDDDDDLSEEDLVFAEHYLKSYYHPATLAGILKKS
TVTSTVDRLREMQSFFGLEVTGKLDDPTLDIMRKPRCGVPDVGEYNVFPRTLKWSQTNLT
YRIVNYTPDMSHSEVEKAFRKAFKVWSDVTPLNFTRIYDGTADIMISFGTKEHGDFYPFD
GPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGAL
MFPIYTYTGKSHFMLPDDDVQGIQFLYGPGDEDPNPKHPKTPEKCDPALSLDAITSLRGE
TMIFKDRFFWRLHPQQVEAELFLTKSFWPELPNHVDAAYEHPSRDLMFIFRGRKFWALNG
YDILEGYPRKISDLGFPKEVKRLSAAVHFENTGKTLFFSENHVWSYDDVNQTMDKDYPRL
IEEEFPGIGNKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSILWC
Download sequence
Identical sequences P33435 Q3U9V5
NP_032633.1.92730 ENSMUSP00000015394 ENSMUSP00000015394 ENSMUSP00000015394 10090.ENSMUSP00000015394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]