SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000015612 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000015612
Domain Number 1 Region: 1571-1816
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.35e-53
Family Ankyrin repeat 0.00000102
Further Details:      
 
Domain Number 2 Region: 475-591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 340-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000895
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 586-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 5 Region: 765-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000185
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 6 Region: 924-1046
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 191-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000931
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 155-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000105
Family EGF-type module 0.013
Further Details:      
 
Domain Number 9 Region: 807-930
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000133
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 675-810
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000392
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 11 Region: 234-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000668
Family EGF-type module 0.033
Further Details:      
 
Domain Number 12 Region: 274-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1249-1280
Classification Level Classification E-value
Superfamily Notch domain 0.000000131
Family Notch domain 0.0021
Further Details:      
 
Domain Number 14 Region: 1043-1087
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000653
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 1211-1242
Classification Level Classification E-value
Superfamily Notch domain 0.00000523
Family Notch domain 0.0065
Further Details:      
 
Domain Number 16 Region: 119-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000135
Family EGF-type module 0.027
Further Details:      
 
Domain Number 17 Region: 29-61
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000172
Family EGF-type module 0.033
Further Details:      
 
Domain Number 18 Region: 1130-1168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000332
Family EGF-type module 0.011
Further Details:      
 
Domain Number 19 Region: 63-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000479
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000015612
Domain Number - Region: 1086-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 318-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00329
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 1172-1200
Classification Level Classification E-value
Superfamily Notch domain 0.00994
Family Notch domain 0.0036
Further Details:      
 
Domain Number - Region: 623-654
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0888
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000015612   Gene: ENSMUSG00000015468   Transcript: ENSMUST00000015612
Sequence length 1964
Comment pep:known chromosome:GRCm38:17:34564268:34588503:1 gene:ENSMUSG00000015468 transcript:ENSMUST00000015612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPQLLLLLLLPLNFPVILTRELLCGGSPEPCANGGTCLRLSRGQGICQCAPGFLGETCQ
FPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCP
PSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCP
PGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSC
LNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCP
KTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPG
YSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGF
TGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGAS
CLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAED
NCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMG
LTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCV
NKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQT
LIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNG
GLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQCAPGYEGQN
CSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACH
SLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTC
SHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNG
TCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCS
LGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFH
NGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLR
VGLWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAGFVVV
MGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRPSANQ
LPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPPL
GEDNIGLKALKPEAEVDEDGVAMCSGPEEGEAEETASASRCQLWPLNSGCGELPQAAMLT
PPQECESEVLDVDTCGPDGVTPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGAC
PQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQL
LLASRQTTVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVN
NARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGLAPGD
VARQRSHWDLLTLLEGAGPTTQEARAHARTTPGGGAAPRCRTLSAGARPRGGGACLQART
WSVDLGARGGKVYARCRSRSGSCGGPTTRGRRFSAGSRGRRGARASQDDWPRDWVALEAC
GSACSAPIPPPSLTPSPERGSPQVAWGLPVHQEIPLNSVVRNLN
Download sequence
Identical sequences A2CG28
ENSMUSP00000015612 10090.ENSMUSP00000015612 ENSMUSP00000015612 ENSMUSP00000015612 NP_035059.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]