SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000016977 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000016977
Domain Number 1 Region: 52-128
Classification Level Classification E-value
Superfamily Ribosomal protein S18 4.58e-26
Family Ribosomal protein S18 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000016977   Gene: ENSMUSG00000016833   Transcript: ENSMUST00000016977
Sequence length 143
Comment pep:known chromosome:GRCm38:5:100798627:100804471:1 gene:ENSMUSG00000016833 transcript:ENSMUST00000016977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVALCSGIGRKNLTTAAGCFTDRGTQAVSVIWRRCFSQFEQVTSNEDLPVPMENPYK
EPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQREITKAIKRAQKMGF
MPVTYKDPAYLKDPRVCNIRYRE
Download sequence
Identical sequences Q8R2L5
ENSMUSP00000016977 ENSMUSP00000016977 ENSMUSP00000016977 NP_081102.1.92730 10090.ENSMUSP00000016977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]