SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000018871 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000018871
Domain Number 1 Region: 11-35
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000143
Family CCCH zinc finger 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000018871
Domain Number - Region: 94-115
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00275
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000018871   Gene: ENSMUSG00000018727   Transcript: ENSMUST00000018871
Sequence length 190
Comment pep:known chromosome:GRCm38:11:113698172:113710017:-1 gene:ENSMUSG00000018727 transcript:ENSMUST00000018871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLF
LHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYFTGFCPEGPQCQFGHCSLST
SHGIQQLLLATLWCPLSRQSPWSTVRGGGVCLRPAAQGHTLHLRPPCQQSKLYPLEPSKP
SLKRGSWTFS
Download sequence
Identical sequences Q9DBA5
NP_084070.1.92730 XP_006533772.1.92730 XP_006533773.1.92730 XP_017170148.1.92730 10090.ENSMUSP00000018871 ENSMUSP00000018871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]