SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000019994 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000019994
Domain Number 1 Region: 125-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000144
Family CO-sensing protein CooA, N-terminal domain 0.086
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000019994
Domain Number - Region: 62-117
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.00392
Family Taf5 N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000019994   Gene: ENSMUSG00000019848   Transcript: ENSMUST00000019994
Sequence length 291
Comment pep:known chromosome:GRCm38:10:45289305:45318452:1 gene:ENSMUSG00000019848 transcript:ENSMUST00000019994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKNSSLWKSLVTEHPLCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG
FLSSAVWAWVDICAADIFSWNFVLFVICFMQFVHIAYQVHSITFARDFHVLYSSLFKPLG
IPLPVFRTIALSSEVVSLEKEHCYAMQGKTSIDRLSVLISGRIRVTVDGEFLHYISPFQF
LDSPEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA
DKLYALNDRVYIGKKHHYDIRLPNYYHMSTPDLSRSPLTEQFRNSRQHCNK
Download sequence
Identical sequences Q9ES81
NP_077248.1.92730 ENSMUSP00000019994 ENSMUSP00000019994 10090.ENSMUSP00000019994 ENSMUSP00000019994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]