SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020251 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020251
Domain Number 1 Region: 445-469
Classification Level Classification E-value
Superfamily Notch domain 0.000068
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000020251
Domain Number - Region: 953-1025
Classification Level Classification E-value
Superfamily EF-hand 0.00363
Family Parvalbumin 0.076
Further Details:      
 
Domain Number - Region: 508-535
Classification Level Classification E-value
Superfamily Notch domain 0.00445
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020251   Gene: ENSMUSG00000035311   Transcript: ENSMUST00000020251
Sequence length 1235
Comment pep:known chromosome:GRCm38:10:88379226:88447329:1 gene:ENSMUSG00000035311 transcript:ENSMUST00000020251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREHMEEEQRAMRETLGKNTTEPTK
KSEKQLECLLTHCIKVPMLVLDPPLPANCTLKDLPTLYPSFHAASDMFNVAKPKNPSTNV
SVVVFDTTKDVEDAHAGPFKGGSKQMVWRAYLTTDKEAPGLVLMQGLAFLSGFPPTFKET
SQLKTKLPEKLSSKIKLLRLYSEASVALLKLNNPKGFQELNKQTKKNMTIDGKELTISPA
YLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDIFQNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNTAGNRFVAG
GGGTGNIGAGQHWQFGGGINTISYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVTLLPNQTHYVVPKGEYLSYFSFANIARRGVEGTYSDNPIIRHASIANKWKTIHL
IMHSGMNATTIYFNLTLQNANDEEFKIQIAVEVDTREAPKLNSTTQKAYESLVSPVTPLP
QADVPFEDVPKEKRFPKIRRHDVNATGRFQEEVKIPRVNISLLPKEAQVRLSNLDLQLER
GDITLKGYNLSKSALLRSFLGNSLDTKIKPQARTDETKGNLEVPQENPSHRRPHGFAGEH
RSERWTAPAETVTVKGRDHALNPPPVLETNARLAQPTLGVTVSKENLSPLIVPPESHLPK
EEESDRAEGNAVPVKELVPGRRLQQNYPGFLPWEKKKYFQDLLDEEESLKTQLAYFTDSK
HTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTS
FHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFHEVDTDQSGVLSDREIRTLATRIHDLP
LSLQDLTGLEHMLINCSKMLPANITQLNNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKI
HKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDA
RTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLII
FTIFSFFAEQIIALKRKIFPRRRIHKEASPDRIRV
Download sequence
Identical sequences Q69ZN6
ENSMUSP00000020251 ENSMUSP00000120643 ENSMUSP00000020251 NP_001004164.2.92730 10090.ENSMUSP00000020251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]