SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020484 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020484
Domain Number 1 Region: 10-390
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.31e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000437
Further Details:      
 
Domain Number 2 Region: 367-498
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.23e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020484   Gene: ENSMUSG00000020250   Transcript: ENSMUST00000020484
Sequence length 499
Comment pep:known chromosome:GRCm38:10:82859206:82897724:1 gene:ENSMUSG00000020250 transcript:ENSMUST00000020484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGSKDPPGSYDFDLIIIGGGSGGLAAAKEAAKFDKKVLVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLMHQAALLGQALKDSRNYGWKVEDTVKHDWEKMTESVQSHIGSLNWGYRVAL
REKKVVYENAYGRFIGPHRIVATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISS
DDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHM
EEHGIKFIRQFVPTKIEQIEAGTPGRLRVTAQSTNSEETIEGEFNTVLLAVGRDSCTRTI
GLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGG
SNVKCDYDNVPTTVFTPLEYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNNK
CYAKIICNLKDDERVVGFHVLGPNAGEVTQGFAAALKCGLTKQQLDSTIGIHPVCAEIFT
TLSVTKRSGGDILQSGCUG
Download sequence
Identical sequences NP_001035978.1.92730 NP_001035979.1.92730 NP_056577.2.92730 ENSMUSP00000020484 ENSMUSP00000020484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]