SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020522 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020522
Domain Number 1 Region: 340-746
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.09e-111
Family Phosphofructokinase 0.0000107
Further Details:      
 
Domain Number 2 Region: 8-347
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.46e-106
Family Phosphofructokinase 0.000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020522   Gene: ENSMUSG00000020277   Transcript: ENSMUST00000020522
Sequence length 780
Comment pep:known chromosome:GRCm38:10:77986947:78009807:-1 gene:ENSMUSG00000020277 transcript:ENSMUST00000020522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
SLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLTIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
AMDEERFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISEGHTVYIVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKPHLEAI
VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWVSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
PVTELKKETDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
Download sequence
Identical sequences P12382
10090.ENSMUSP00000020522 ENSMUSP00000020522 NP_032852.2.92730 ENSMUSP00000020522 ENSMUSP00000020522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]