SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020629 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020629
Domain Number 1 Region: 319-682
Classification Level Classification E-value
Superfamily SIS domain 9.28e-107
Family double-SIS domain 0.000000478
Further Details:      
 
Domain Number 2 Region: 2-209,250-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.26e-56
Family Class II glutamine amidotransferases 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020629   Gene: ENSMUSG00000020363   Transcript: ENSMUST00000020629
Sequence length 682
Comment pep:known chromosome:GRCm38:11:49794187:49838613:1 gene:ENSMUSG00000020363 transcript:ENSMUST00000020629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIFAYMNYRVPKTRKEIFETLIRGLQRLEYRGYDSAGVAIDGNNHEVKERHIHLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKDNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPVLYPTCNIENVKNICKTRMK
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAT
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences Q9Z2Z9
10090.ENSMUSP00000020629 NP_038557.1.92730 ENSMUSP00000020629 ENSMUSP00000020629 ENSMUSP00000020629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]