SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020643 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020643
Domain Number 1 Region: 113-279
Classification Level Classification E-value
Superfamily RUN domain-like 7.06e-51
Family RUN domain 0.000000213
Further Details:      
 
Domain Number 2 Region: 642-709
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.49e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00095
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000020643
Domain Number - Region: 434-531
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0118
Family Myosin rod fragments 0.0058
Further Details:      
 
Domain Number - Region: 303-375
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0863
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020643   Gene: ENSMUSG00000020375   Transcript: ENSMUST00000020643
Sequence length 712
Comment pep:known chromosome:GRCm38:11:50389286:50431125:-1 gene:ENSMUSG00000020375 transcript:ENSMUST00000020643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARGECRRAGQDSEPEPEREPESEPGPEPEPQAGLESGEAFEIVDRSQLPSPGELRSAS
RPRVADSWSAPILTLARRATGNLSASCGSALRAAAGLGDGGGGGERAASKGQMMEERANL
MHMMKLSIKVLLQSALSLGRSLDADYAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGP
LELVEKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKQLLSE
FYEPEALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLCLKDAQDLDSGR
EHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQKE
QQQLREQNEVIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLE
LEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKVQSAESS
LQQKNEAIASFEGKTTQVMSSMKQMEERLQQAERARQAAEERSHKLQQELSGRGSALQLQ
LSQLRDQCSGLEKELKSEKEQRQALQRELQREKDTSCLLQTELQQVEGLKKELRELQDEK
AELRKVCEEQEQALQEMGLHLSQSKLKMEDIKEVNKALKGHTWLKDDEATHCKQCEKDFS
ISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
Download sequence
Identical sequences Q8BIJ7
ENSMUSP00000020643 NP_766145.1.92730 10090.ENSMUSP00000020643 ENSMUSP00000020643 ENSMUSP00000020643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]