SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000020683 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000020683
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000558
Family DNA polymerase processivity factor 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000020683   Gene: ENSMUSG00000020413   Transcript: ENSMUST00000020683
Sequence length 281
Comment pep:known chromosome:GRCm38:11:8993137:9011191:-1 gene:ENSMUSG00000020413 transcript:ENSMUST00000020683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDLACLNHFTRVSNMIAKLAKTCTLRISPEKLNFILCDKLASGGVSMWCELEQ
ENFFSEFQMEGVSEENNEIYLELTSENLSRALKTAQNSRALKIKLTNKHFPCLTVSVELQ
VSSSSSSRIVVHDIPIKVLPRRLWKDLQEPSIPDCDVSICLPALKMMKSVVEKMRNISNQ
LVIEANLKGELNLKIETELVCVTTHFKDLENPLLPSDSVSQNRHPEDMAKVHIDIKKLLQ
FLAGQQVTPTKAVCNIVNNRTVHFDLLLEDVSLQYFIPALS
Download sequence
Identical sequences ENSMUSP00000020683 ENSMUSP00000020683 ENSMUSP00000020683 ENSMUSP00000114339 NP_032342.1.92730 10090.ENSMUSP00000114339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]