SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021090 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021090
Domain Number 1 Region: 55-154,184-210
Classification Level Classification E-value
Superfamily SH2 domain 1.56e-31
Family SH2 domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 2-77
Classification Level Classification E-value
Superfamily SH3-domain 6.14e-21
Family SH3-domain 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021090   Gene: ENSMUSG00000059923   Transcript: ENSMUST00000021090
Sequence length 217
Comment pep:known chromosome:GRCm38:11:115644045:115708597:-1 gene:ENSMUSG00000059923 transcript:ENSMUST00000021090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Download sequence
Identical sequences A0A1A6G472 Q3U5I5 Q60631
ENSMUSP00000021090 10090.ENSMUSP00000021090 NP_001300865.1.92730 NP_001300866.1.92730 NP_032189.1.92730 XP_021067277.1.100879 XP_021067278.1.100879 XP_021067279.1.100879 ENSMUSP00000021090 ENSMUSP00000102106 ENSMUSP00000021090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]