SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021166 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021166
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 3.8e-42
Family Globins 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021166   Gene: ENSMUSG00000020810   Transcript: ENSMUST00000021166
Sequence length 190
Comment pep:known chromosome:GRCm38:11:116645595:116654313:-1 gene:ENSMUSG00000020810 transcript:ENSMUST00000021166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGDMEIERRERSEELSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFRHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PMYFKILSGVILEVIAEEFANDFPVETQKAWAKLRGLIYSHVTAAYKEVGWVQQVPNTTT
PPATLPSSGP
Download sequence
Identical sequences Q546K1 Q9CX80
ENSMUSP00000021166 ENSMUSP00000021166 10090.ENSMUSP00000021166 ENSMUSP00000021166 NP_084482.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]