SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000021614 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000021614
Domain Number 1 Region: 348-771
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.57e-110
Family Phosphofructokinase 0.00000754
Further Details:      
 
Domain Number 2 Region: 11-357
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.4e-110
Family Phosphofructokinase 0.000000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000021614   Gene: ENSMUSG00000021196   Transcript: ENSMUST00000021614
Sequence length 784
Comment pep:novel chromosome:GRCm38:13:6581182:6648725:-1 gene:ENSMUSG00000021196 transcript:ENSMUST00000021614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLDSSSSSAYPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFIY
EGYQGLVDGGSNIVEAKWDCVSSILQVGGTIIGSARCKAFRSREGRLKAACNLARLGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGDIDNDTVQKYSYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALTCGADWVFLPE
SPPEEDWEENMCLKLSENRARKKRLNIIIVSEGAIDMQNKPITSEKIKELVVKNLGFDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPETPACVVSLRGNQAVRLPLMECV
QMTQDVQKAMDERRFKEAVKLRGRRFEGNLNTYKRLAIKLPDEKIVKSNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHKMFAIYDGFEGFANGQIKEIGWADVGGWTGQGGSILGTKR
TLPGKYLEKIAEQMHSHSINALLIIGGFEGYHGAIMLSEARNNHEEFCIPICVLPATISN
DIPGSDISIGCDTALNVIVETCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGAD
AAYIFEEPFDIGDLQSNVVHLTEKMKTSIQRGLVLRNESCSVNYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSQGTGKKFVSDDSICVLG
ICKRDLLFQPVAELKKVTDFEHRIPKEQWWLKLRPIMKILAKYEASYDMSDSGKLESLQH
HEEL
Download sequence
Identical sequences Q8C605
NP_001278000.1.92730 ENSMUSP00000021614 ENSMUSP00000021614 ENSMUSP00000114439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]