SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022227 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000022227
Domain Number - Region: 52-225
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0238
Family Reprolysin-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022227   Gene: ENSMUSG00000021714   Transcript: ENSMUST00000022227
Sequence length 306
Comment pep:known chromosome:GRCm38:13:104229388:104249615:1 gene:ENSMUSG00000021714 transcript:ENSMUST00000022227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPCSVYSNNKAASCTTSPLVIYSSCSKVKKTIKDMSENKQEVHPDTITDVEAVIDTEEE
LIKECEEMWKDMEDCQNKLSLIGTETLTNADAQLSLLIMQMKCLTAELGQWKKRKPEIIP
LNEDVLLTLGKEEFQKLRCDLEMVLSTIQSKNEKLKEDLEREQQWLDEQQQILDTLNVLN
SDVENQVVTLTESRIFNELTTKIRGIKEFKEKLLLTLGAFLDNHFPLPEASTPKKRKNIQ
DSNAQLITLNEILEMLINRMFDVPHDPYVKIRDSFWPPYIELLLRYGIALRHPEDPSQIR
LEAFHQ
Download sequence
Identical sequences A0A0R4J037
ENSMUSP00000022227 NP_068562.1.92730 ENSMUSP00000022227 ENSMUSP00000022227 10090.ENSMUSP00000022227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]