SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022314 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022314
Domain Number 1 Region: 134-248
Classification Level Classification E-value
Superfamily C-type lectin-like 1.89e-28
Family C-type lectin domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 104-129
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.000000000242
Family Triple coiled coil domain of C-type lectins 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022314   Gene: ENSMUSG00000021789   Transcript: ENSMUST00000022314
Sequence length 248
Comment pep:known chromosome:GRCm38:14:41131782:41134476:1 gene:ENSMUSG00000021789 transcript:ENSMUST00000022314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGSLAFTLFLTVVAGIKCNGTEVCAGSPGIPGTPGNHGLPGRDGRDGIKGDPGPPGPM
GPPGGMPGLPGRDGLPGAPGAPGEHGDKGEPGERGLPGFPAYLDEELQTALYEIKHQILQ
TMGVLSLQGSMLSVGDKVFSTNGQSVNFDTIREMCTRAGGHIAAPRNPEENEAIASITKK
YNTYPYLGVIEGQTPGDFHYLDGASVNYTNWYPGEPRGRGKEKCVEMYTDGKWNDKGCLQ
YRLAICEF
Download sequence
Identical sequences Q9CQI1
ENSMUSP00000022314 ENSMUSP00000129696 ENSMUSP00000022314 ENSMUSP00000022314 10090.ENSMUSP00000022314 NYSGRC-LECT-ENSMUSP00000022314 NP_075623.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]