SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000022856 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000022856
Domain Number 1 Region: 154-273
Classification Level Classification E-value
Superfamily DNA clamp 1.16e-18
Family DNA polymerase processivity factor 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000022856
Domain Number - Region: 36-100
Classification Level Classification E-value
Superfamily DNA clamp 0.0182
Family DNA polymerase processivity factor 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000022856   Gene: ENSMUSG00000022248   Transcript: ENSMUST00000022856
Sequence length 280
Comment pep:known chromosome:GRCm38:15:10486018:10493689:1 gene:ENSMUSG00000022248 transcript:ENSMUST00000022856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQYNEEEYEQYCLVASLDNVRNLSTVLKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQADVFQEFVIQEESVTFRINLTILLDCLSIFGSSPTPGTLTALRMCYQGYGHPLM
LFLEEGGVVTVCKITTQEPEETLDFDFCSTNVMNKIILQSEGLREAFSELDMTGDVLQIT
VSPDKPYFRLSTFGNAGNSHLDYPKDSDLVEAFHCDKTQVNRYKLSLLKPSTKALALSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
Download sequence
Identical sequences Q9QWZ1
ENSMUSP00000022856 ENSMUSP00000098338 ENSMUSP00000022856 NP_001276376.1.92730 NP_035362.2.92730 10090.ENSMUSP00000022856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]