SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023494 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023494
Domain Number 1 Region: 141-241
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000128
Family cAMP-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023494   Gene: ENSMUSG00000022803   Transcript: ENSMUST00000023494
Sequence length 371
Comment pep:novel chromosome:GRCm38:16:38362209:38378216:1 gene:ENSMUSG00000022803 transcript:ENSMUST00000023494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANGSSVAQLLWQPPVCRSWKPDVEGAVYHLANCFLLMGFMAGSGVYGCFYLFGILGPG
YLCCVLWGWFDACGLDIVLWNVLLTVACLLQLAQLVYRVRVNTLPEEFNLLYRTLCLPLQ
VPLQVYKEIVHCCHEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPY
QFMDSPEWESLHPSEEGTFQVTLTAETECSYISWPRKNLYLLLNRERYISRLFSALLGYD
ISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLSPSASDGEPESEKDDEEALEAAVSPAQAR
PICIVPTPPCSAPPATTNFPVPLPRARMPRMPRPDSGNLGEDSTSLVLEDFEEVSGSESF
MDYRSDGEYMR
Download sequence
Identical sequences Q6P3F7
ENSMUSP00000023494 NP_001075453.1.92730 10090.ENSMUSP00000023494 ENSMUSP00000023494 ENSMUSP00000023494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]