SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023510 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023510
Domain Number 1 Region: 236-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.38e-56
Family Decarboxylase 0.00000054
Further Details:      
 
Domain Number 2 Region: 10-205
Classification Level Classification E-value
Superfamily PRTase-like 2.96e-43
Family Phosphoribosyltransferases (PRTases) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023510   Gene: ENSMUSG00000022814   Transcript: ENSMUST00000023510
Sequence length 481
Comment pep:known chromosome:GRCm38:16:33954782:33967038:-1 gene:ENSMUSG00000022814 transcript:ENSMUST00000023510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVASQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQT
AKNAGISFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCL
VIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQML
EILQQQEKIDADMVGRVKRFIQENVFSAANHNGLPPPEKKACKELSFGARAELPGTHPLA
SKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTA
LAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLP
LHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQ
LETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWEAYLSRLAV
Q
Download sequence
Identical sequences P13439 Q544K9
10090.ENSMUSP00000023510 399847 ENSMUSP00000023510 NP_033497.1.92730 ENSMUSP00000023510 ENSMUSP00000023510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]