SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000023987 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000023987
Domain Number 1 Region: 145-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.13e-84
Family Transglutaminase core 0.000000797
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 2.27e-39
Family Transglutaminase N-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 472-542
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000000000000471
Family Transglutaminase, two C-terminal domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000023987   Gene: ENSMUSG00000023216   Transcript: ENSMUST00000023987
Sequence length 673
Comment pep:novel chromosome:GRCm38:2:121023650:121036835:-1 gene:ENSMUSG00000023216 transcript:ENSMUST00000023987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQALSIKSCDFHAAENNEEHYTKAISSQHLTLRRGQSFTITLNFRAPTHTFLSALKKVA
LIAQTGEQPSKINKTQAIFPISSLGDQKGWSAAVEERDAQHWTVSVTTPVDAVIGHYSLL
LQVSGKKQYPLGQFTLLFNPWNRDDAVFLQNEAERTEYVLNQNGFIYLGTADCIQEEPWD
FGQFEKDVMDLSLKLLSMDKQVKDWNQPAHVARVVGALLHALKKKSVLPISQTQAAQEGA
LLYKRRGSVPILRQWLTGQGRAVYETQAWVSAAVACTVLRCLGIPARVVTTFDSAQGTVG
SLLVDEYYNEEGLQNGEGQRGHIWVFQTSVECWMNRPDLSQGYGGWQILHPRAPNGAGVL
GSCSLVPVRAVKEGELQLDPAVPELFAAVNASCVVWKCCEDGKLELTNSNRKDVGNCIST
KVVGSDRCEDITQNYKYPAGSLQEKEVLEKVQKERLKLGKDNGMCPPSCEPWDPLHMFFE
ASSSIPLSGDGQLSVTLINPTDEEKKVHLVIGAQALYYNGVLAAGLWSKKQLFMLKPNQG
NSLWPQRTPCTHMVLSWAPPMGSQRQLLAPWCSLLFNTYTFTYTVTQHLYIHSDTLRGPQ
SQLQLDKYTAHPVVRKHLGRPTECRTGSPLSRLGSLHPDDPQKAVLKNEEGPARKMYQAF
QTEGRCTRVPSLF
Download sequence
Identical sequences Q3UV95
ENSMUSP00000023987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]