SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000024696 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000024696
Domain Number 1 Region: 368-563
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.24e-54
Family Hemopexin-like domain 0.0000144
Further Details:      
 
Domain Number 2 Region: 115-333
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.11e-47
Family Matrix metalloproteases, catalytic domain 0.0000275
Further Details:      
 
Domain Number 3 Region: 73-150
Classification Level Classification E-value
Superfamily PGBD-like 2.04e-18
Family MMP N-terminal domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000024696   Gene: ENSMUSG00000023903   Transcript: ENSMUST00000024696
Sequence length 615
Comment pep:known chromosome:GRCm38:17:23629458:23645269:-1 gene:ENSMUSG00000023903 transcript:ENSMUST00000024696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFPGSQISPARLYYLVSAPWICTGSLTSSRLPRRRESGPLRVPPRSVQAERILRLPAFG
LPLLALLLVPLLPVRAQNPDAKVVSMGVEWLTRYGYLPPADPVHAQMQSLEKLQDAIKVM
QRFAGLPETGQMDPMTIKTMRKPRCSLPDVLGAAGLVRRRRRYSLSGSVWKKRTLTWSIR
SFSQKSQLSPQIVRTLLSYALAVWATESGLTFQEVNSQYQEPDIIIHFARAYHQDSYPFD
GSGGTLAHAFFPGEHPISGDTHFDDEETWTFGSTDDNGIDLFAVAVHEFGHALGLGHSSA
PNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYGRVSQNPNARPTRKPLVPPPQPPAMPP
DSPATPVPDRCEGNFDAVANIRGEIFLFKGPWFWRLQPSGQLVSPRPAGLHRFWEGLPTH
VKVIQAAYARPLDGRIILFSGPQFWVFQERQLEGAARPLVEFGLPPGEDVDAVFSWPHNG
KTYLIRGQKYWRYDEVAARPDPGYPRALSLWDGAPFAPDDVTISNTGDTYFFKGTHFWRF
AEGSVKAESDSPQPIGPKWLDCPAPNSDPRVTSPPKTTSKTRSCDCHCELNQASEQLSPL
LLPLLPLVAGEVFSY
Download sequence
Identical sequences Q3U435
NP_001028511.1.92730 10090.ENSMUSP00000024696 ENSMUSP00000024696 ENSMUSP00000024696 ENSMUSP00000024696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]