SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000024733 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000024733
Domain Number 1 Region: 36-279
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.24e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000408
Further Details:      
 
Domain Number 2 Region: 280-480
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 6.02e-45
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00017
Further Details:      
 
Domain Number 3 Region: 619-781
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.29e-33
Family AlaX-like 0.091
Further Details:      
 
Domain Number 4 Region: 539-615
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000321
Family AlaX-M N-terminal domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000024733   Gene: ENSMUSG00000023938   Transcript: ENSMUST00000024733
Sequence length 980
Comment pep:known chromosome:GRCm38:17:45506841:45520842:1 gene:ENSMUSG00000023938 transcript:ENSMUST00000024733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALAAAAGKLRRAIGRSCPWQPFSTEPGPPHGAAVRDAFLSFFRDRHGHRLVPSATVR
PRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVVNSQKCVRAGGRHNDLEDVGRDL
SHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPEDRLWVSYFSGDSQTGLDPDLE
TRDIWLSLGVPASRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGVGSPQLVELWNLVF
MQHYREADGSLQLLPQRHVDTGMGLERLVAVLQGKRSTYDTDLFSPLLDAIHQSCGAPPY
SGRVGAADEGRIDTAYRVVADHIRTLSVCIADGVSPGMSGAPLVLRRILRRAVRYSTEVL
QAPPGFLGSLVPVVVETLGSAYPELEKNSVKIASLVSEDEAAFLASLQRGRRIIDRTVKR
LGPSDLFPAEVAWSLSLSGNLGIPLDLVELMLEEKGVKLDTAGLEQLAQKEAQHRAQQAE
ADQEDRLCLDVHALEELHRQGIPTTDDSPKYNYTLHPNGDYEFGLCEARVLQLYSETGTA
VASVGAGQRCGLLLDRTNFYAEQGGQASDRGYLVRTGQQDMLFPVAGAQLCGGFILHEAM
APERLQVGDQVQLYVDKAWRMGCMVKHTATHLLSWALRQTLGPTTEQRGSHLNPERLRFD
VATQTLLTTEQLRTVESYVQEVVGQDKPVFMEEVPLAHTARIPGLRSLDEVYPDPVRVVS
VGVPVAHALGPASQAAMHTSVELCCGTHLLSTGAVGDLVIIGERQLVKGITRLLAITGEQ
AQQAREVGQSLSQEVEAASERLSQGSRDLPEAHRLSKDIGRLTEVAESAVIPQWQRQELQ
TTLKMLQRRANTAIRKLEKGQATEKSQELLKRHSEGPLIVDTVSAESLSVLVKVVRQLCK
QAPSISVLLLSPQPTGSVLCACQVAQDATPTFTAEAWALAVCSHMGGKAWGSRVVAQGTG
HTADLEAALGTARAYALSQL
Download sequence
Identical sequences Q14CH7
10090.ENSMUSP00000024733 NP_941010.2.92730 ENSMUSP00000024733 ENSMUSP00000024733 ENSMUSP00000024733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]