SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025305 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025305
Domain Number 1 Region: 89-168
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.1e-24
Family Ribosomal protein S18 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025305   Gene: ENSMUSG00000024436   Transcript: ENSMUST00000025305
Sequence length 254
Comment pep:known chromosome:GRCm38:17:35910379:35916389:-1 gene:ENSMUSG00000024436 transcript:ENSMUST00000025305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLRHTLLKLVPTLLRSSYVAQVPLQTLCTRGPPEEDAPSSLPVSPYESEPWKYLDSE
EYHNRYGSRPVWADYRRNHKGGVPPQRTRKTCIRNNKVAGNPCPICRDHKLHVDFRNVKL
LEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARECGLLSYYVPQVEPRDADFGTVHG
AVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEESGPPPESMPEMPTTP
PAESSIEQPGSQSA
Download sequence
Identical sequences Q99N84
ENSMUSP00000109412 NP_080154.1.92730 10090.ENSMUSP00000025305 ENSMUSP00000025305 ENSMUSP00000025305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]